Loading...
Statistics
Advertisement

SHEDLOCK | Auto Care Specialists
www.shedlockcarcare.com/
Sshedlock Auto Care Specialists in Warren NJ

Shedlockcarcare.com

Advertisement
Shedlockcarcare.com is hosted in Canada / Toronto . Shedlockcarcare.com uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by Shedlockcarcare.com

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • nginx

Powered by

  • PleskLin

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Shedlockcarcare.com

SSL certificate

    • name: /C=US/ST=Virginia/L=Herndon/O=Parallels/OU=Parallels Panel/CN=Parallels Panel/emailAddress=info@parallels.com
    • subject:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: Parallels
      • OU: Parallels Panel
      • CN: Parallels Panel
      • emailAddress: info@parallels.com
    • hash: 74e1f02f
    • issuer:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: Parallels
      • OU: Parallels Panel
      • CN: Parallels Panel
      • emailAddress: info@parallels.com
    • version: 0
    • serialNumber: 1338956323
    • validFrom: 120606041843Z
    • validTo: 130606041843Z
    • validFrom_time_t: 1338956323
    • validTo_time_t: 1370492323
    • extensions:

    Meta - Shedlockcarcare.com

    Number of occurences: 3
    • Name:
      Content: no-cache
    • Name: description
      Content: Sshedlock Auto Care Specialists in Warren NJ
    • Name: keywords
      Content: Shedlock, Auto Care Specialists, Auto Detailing, Warren, NJ, New Jersey, Rims, Wheels, Tires, Service, Trump Partner, Joe Shedlock

    Server / Hosting

    • IP: 216.107.18.2
    • Latitude: 43.62
    • Longitude: -79.39
    • Country: Canada
    • City: Toronto

    Rname

    • ns2.gti.net
    • ns.gti.net
    • mail.shedlockcarcare.com

    Target

    • hostmaster.gti.net

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx Date: Fri, 06 May 2016 18:08:47 GMT Content-Type: text/html Content-Length: 1322 X-Accel-Version: 0.01 Last-Modified: Mon, 14 Dec 2015 14:42:56 GMT ETag: "12610f2-52a-526dcb0536e33" Accept-Ranges: bytes X-Powered-By: PleskLin X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive

    DNS

    host: shedlockcarcare.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 216.107.18.2
    host: shedlockcarcare.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.gti.net
    host: shedlockcarcare.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns.gti.net
    host: shedlockcarcare.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns.gti.net
    5. rname: hostmaster.gti.net
    6. serial: 4
    7. refresh: 3600
    8. retry: 900
    9. expire: 604800
    10. minimum-ttl: 3600
    host: shedlockcarcare.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 1
    5. target: mail.shedlockcarcare.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.hedlockcarcare.com, www.sehedlockcarcare.com, www.ehedlockcarcare.com, www.swhedlockcarcare.com, www.whedlockcarcare.com, www.sdhedlockcarcare.com, www.dhedlockcarcare.com, www.sxhedlockcarcare.com, www.xhedlockcarcare.com, www.sfhedlockcarcare.com, www.fhedlockcarcare.com, www.sghedlockcarcare.com, www.ghedlockcarcare.com, www.sthedlockcarcare.com, www.thedlockcarcare.com, www.sedlockcarcare.com, www.sheedlockcarcare.com, www.seedlockcarcare.com, www.shdedlockcarcare.com, www.sdedlockcarcare.com, www.shcedlockcarcare.com, www.scedlockcarcare.com, www.shuedlockcarcare.com, www.suedlockcarcare.com, www.shjedlockcarcare.com, www.sjedlockcarcare.com, www.shedlockcarcare.com, www.sedlockcarcare.com, www.shbedlockcarcare.com, www.sbedlockcarcare.com, www.shgedlockcarcare.com, www.sgedlockcarcare.com, www.shdlockcarcare.com, www.shexdlockcarcare.com, www.shxdlockcarcare.com, www.shesdlockcarcare.com, www.shsdlockcarcare.com, www.shewdlockcarcare.com, www.shwdlockcarcare.com, www.sherdlockcarcare.com, www.shrdlockcarcare.com, www.shefdlockcarcare.com, www.shfdlockcarcare.com, www.shevdlockcarcare.com, www.shvdlockcarcare.com, www.shecdlockcarcare.com, www.shcdlockcarcare.com, www.sheqdlockcarcare.com, www.shqdlockcarcare.com, www.sheadlockcarcare.com, www.shadlockcarcare.com, www.sheydlockcarcare.com, www.shydlockcarcare.com, www.shelockcarcare.com, www.shedtlockcarcare.com, www.shetlockcarcare.com, www.shedglockcarcare.com, www.sheglockcarcare.com, www.shedblockcarcare.com, www.sheblockcarcare.com, www.shedxlockcarcare.com, www.shexlockcarcare.com, www.shedslockcarcare.com, www.sheslockcarcare.com, www.shedflockcarcare.com, www.sheflockcarcare.com, www.shedvlockcarcare.com, www.shevlockcarcare.com, www.shedylockcarcare.com, www.sheylockcarcare.com, www.shedzlockcarcare.com, www.shezlockcarcare.com, www.shedalockcarcare.com, www.shealockcarcare.com, www.shedelockcarcare.com, www.sheelockcarcare.com, www.shedrlockcarcare.com, www.sherlockcarcare.com, www.shedockcarcare.com, www.shedluockcarcare.com, www.sheduockcarcare.com, www.shedl8ockcarcare.com, www.shed8ockcarcare.com, www.shedl9ockcarcare.com, www.shed9ockcarcare.com, www.shedljockcarcare.com, www.shedjockcarcare.com, www.shedl0ockcarcare.com, www.shed0ockcarcare.com, www.shedlmockcarcare.com, www.shedmockcarcare.com, www.shedlpockcarcare.com, www.shedpockcarcare.com, www.shedloockcarcare.com, www.shedoockcarcare.com, www.shedlckcarcare.com, www.shedlobckcarcare.com, www.shedlbckcarcare.com, www.shedlohckcarcare.com, www.shedlhckcarcare.com, www.shedlogckcarcare.com, www.shedlgckcarcare.com, www.shedlojckcarcare.com, www.shedljckcarcare.com, www.shedlomckcarcare.com, www.shedlmckcarcare.com, www.shedlo ckcarcare.com, www.shedl ckcarcare.com, www.shedlovckcarcare.com, www.shedlvckcarcare.com, www.shedlokcarcare.com, www.shedlocdkcarcare.com, www.shedlodkcarcare.com, www.shedlocrkcarcare.com, www.shedlorkcarcare.com, www.shedloctkcarcare.com, www.shedlotkcarcare.com, www.shedlocvkcarcare.com, www.shedlovkcarcare.com, www.shedlocfkcarcare.com, www.shedlofkcarcare.com, www.shedlocgkcarcare.com, www.shedlogkcarcare.com, www.shedlochkcarcare.com, www.shedlohkcarcare.com, www.shedlocnkcarcare.com, www.shedlonkcarcare.com, www.shedlocmkcarcare.com, www.shedlomkcarcare.com, www.shedlocjkcarcare.com, www.shedlojkcarcare.com, www.shedloccarcare.com, www.shedlocktcarcare.com, www.shedloctcarcare.com, www.shedlockcarcare.com, www.shedloccarcare.com, www.shedlockgcarcare.com, www.shedlocgcarcare.com, www.shedlockbcarcare.com, www.shedlocbcarcare.com, www.shedlockncarcare.com, www.shedlocncarcare.com, www.shedlockhcarcare.com, www.shedlochcarcare.com, www.shedlockycarcare.com, www.shedlocycarcare.com, www.shedlocklcarcare.com, www.shedloclcarcare.com, www.shedlockocarcare.com, www.shedlococarcare.com, www.shedlockucarcare.com, www.shedlocucarcare.com, www.shedlockicarcare.com, www.shedlocicarcare.com, www.shedlockmcarcare.com, www.shedlocmcarcare.com, www.shedlockarcare.com, www.shedlockcdarcare.com, www.shedlockdarcare.com, www.shedlockcrarcare.com, www.shedlockrarcare.com, www.shedlockctarcare.com, www.shedlocktarcare.com, www.shedlockcvarcare.com, www.shedlockvarcare.com, www.shedlockcfarcare.com, www.shedlockfarcare.com, www.shedlockcgarcare.com, www.shedlockgarcare.com, www.shedlockcharcare.com, www.shedlockharcare.com, www.shedlockcnarcare.com, www.shedlocknarcare.com, www.shedlockcmarcare.com, www.shedlockmarcare.com, www.shedlockcjarcare.com, www.shedlockjarcare.com,

    Other websites we recently analyzed

    1. Newgotiate • Untertitel
      Germany - 134.119.45.44
      Server software: Apache/2.4.10
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 4
      Number of meta tags: 3
    2. Benteng Mas Perkasa - Master Dealer of Grundfos Pumps
      Master Dealer / Distributor Pompa Air Grundfos Jakarta / Jabodetabek, kami telah berpengalaman lebih dari 20 tahun di bidang plumbing.
      Chicago (United States) - 50.31.162.83
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, Zopim Live Chat, Google Analytics, Joomla, Virtuemart, Facebook Box
      Number of Javascript: 18
      Number of meta tags: 6
    3. FrancineHuot.com
      Welcome to FrancineHuot.com. Bienvenue sur le site FrancineHuot.com
      Scottsdale (United States) - 50.62.160.219
      G Analytics ID: UA-58256132-1
      Server software: Microsoft-IIS/8.0
      Technology: CSS, Html, Html5, Php, Google Analytics
      Number of Javascript: 1
      Number of meta tags: 2
    4. Ronni Jolles | Painting With Paper Artist
      “Painting with paper” is the best way to express what I do. Paper – in its multitude of colors and textures – is the essence of my work, and subjects come into
      Culver City (United States) - 205.186.183.143
      Server software: Sun-ONE-Web-Server/6.1
      Technology: CSS, Html, Html5, Javascript, SVG, Google Analytics, Wordpress
      Number of Javascript: 9
      Number of meta tags: 4
    5. Siamexim - Thiết bị nhà bếp cao cấp
      Công ty chuyên nhập khẩu và phân phối độc quyền thiết bị nhà bếp, đồ gia dụng cao cấp Thái Lan.
      United States - 31.220.110.35
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery, jQuery UI, Php, Facebook Box
      Number of Javascript: 10
      Number of meta tags: 4
    6. risperdaltardivedyskinesialawsuit.com
      Albuquerque (United States) - 129.121.40.24
      Server software: nginx
      Technology: Html
      Number of meta tags: 1
    7. gns.no
      Norway - 91.221.130.155
      Server software: Apache
      Technology: Html, Php
    8. systemsshopper.com - Diese Website steht zum Verkauf! - Informationen zum Thema computer home audio.
      Diese
      Cambridge (United States) - 72.52.4.119
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, Html, Html5, Javascript, Php
      Number of Javascript: 3
      Number of meta tags: 5
    9. Global Future Ltd.
      Scottsdale (United States) - 184.168.224.170
      Server software: Microsoft-IIS/8.0
      Technology: CSS, Flexslider, Html, Iframe, Javascript
      Number of Javascript: 4
      Number of meta tags: 3
    10. Webdesign Komplettpaket zum Festpreis - für alle Branchen!
      Sie suchen ein Webdesign im Paket zum Komplettpreis? Wählen Sie in nur 3 Schritten Ihr Komplettpaket - für alle Branchen! Professionell & günstig!
      France - 5.196.189.250
      G Analytics ID: UA-20632638-14
      Server software: Apache/2.2.16 (Debian)
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Google Analytics, Wordpress
      Number of Javascript: 20
      Number of meta tags: 5

    Check Other Websites